PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.V6VZI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 107aa    MW: 12522.4 Da    PI: 10.1654
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.V6VZIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY55.51.1e-1749862259
                 EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 +sYYrCt++gC+vkk+v+r ++d+ +v++tYeg H+h+
  Araip.V6VZI 49 QSYYRCTHQGCNVKKQVQRLTKDEGIVVTTYEGVHTHP 86
                 79***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007741.1E-133687IPR003657WRKY domain
PfamPF031061.1E-134686IPR003657WRKY domain
SuperFamilySSF1182904.58E-154887IPR003657WRKY domain
PROSITE profilePS5081115.9044988IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-164986IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
GVDLHHHPTR RKERRKLENQ DTRFKPGAKL IFLMMVIDGG NMAKRLKGQS YYRCTHQGCN  60
VKKQVQRLTK DEGIVVTTYE GVHTHPIEKT TDNFEHILSQ MQIYTPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-46AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207764.15e-37PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA25e-30WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0B2P7302e-36A0A0B2P730_GLYSO; Putative WRKY transcription factor 75
TrEMBLA0A0R4J6142e-36A0A0R4J614_SOYBN; Uncharacterized protein
TrEMBLA0A151QUC91e-36A0A151QUC9_CAJCA; Putative WRKY transcription factor 75
STRINGGLYMA19G26400.15e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-31WRKY DNA-binding protein 75